DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and AT4G25790

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_194309.1 Gene:AT4G25790 / 828684 AraportID:AT4G25790 Length:210 Species:Arabidopsis thaliana


Alignment Length:169 Identity:44/169 - (26%)
Similarity:60/169 - (35%) Gaps:51/169 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SGEFVQ--VDAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQ----C 109
            :|.|.|  :|.|            |.:.||  .|.|..|      ||..:|..|.:.|.|    |
plant    71 TGSFEQQFLDPH------------NTVRGG--LGLPPLV------WDVKIASYATWWANQRRYDC 115

  Fly   110 RMAHDECRNTNTYRYAGQNL----SILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGG 170
            .:.|    :|..|   |:||    ...||.:.        .:.:|..|   |.|.:.......|.
plant   116 SLTH----STGPY---GENLFWGSGSDFTSTF--------AVESWTVE---AKSYNHMTNTCEGD 162

  Fly   171 PAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNY 209
            ...||:|.:|.....|:||  ||.. ..|.....:.|||
plant   163 GMCGHYTQIVWRETRRLGC--ARVV-CENGAGVFITCNY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 39/155 (25%)
AT4G25790NP_194309.1 CAP_PR-1 76..210 CDD:349400 42/164 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.