DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and AT4G25780

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_194308.1 Gene:AT4G25780 / 828683 AraportID:AT4G25780 Length:190 Species:Arabidopsis thaliana


Alignment Length:215 Identity:52/215 - (24%)
Similarity:63/215 - (29%) Gaps:83/215 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIIFTFTFAQNY--CDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHNERRNLIAG 77
            ||..:.|..|.:  | ..|||               ||..:.:|       .|..||..|     
plant    27 LITKSATLGQVFRIC-KNLCP---------------GCDHDSLQ-------FLFRHNLVR----- 63

  Fly    78 GGVSGFPSAVQMATMSWDTTLAQLAAYNALQ----CRMAHDECR-----NTNTYRYAGQNLSILF 133
                   :|.....:.||..|...|...|.|    |.:.|....     ..|.|...|.|.|   
plant    64 -------AARFEPPLIWDRRLQNYAQGWANQRRGDCALRHSVSNGEFNLGENIYWGYGANWS--- 118

  Fly   134 TRSVDVAVFLRQRIAAWFDENR---------DATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGC 189
              ..|..|       ||..|.|         ||            |...||:|.:|.:...||||
plant   119 --PADAVV-------AWASEKRFYHYGSNTCDA------------GQMCGHYTQIVWKSTRRVGC 162

  Fly   190 AIARFTDANNVQATLLACNY 209
              ||....|.  ...:.|||
plant   163 --ARVVCDNG--GIFMTCNY 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 41/165 (25%)
AT4G25780NP_194308.1 CAP_PR-1 54..190 CDD:349400 42/172 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.