DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and AT4G07820

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_192524.1 Gene:AT4G07820 / 826263 AraportID:AT4G07820 Length:160 Species:Arabidopsis thaliana


Alignment Length:169 Identity:36/169 - (21%)
Similarity:56/169 - (33%) Gaps:60/169 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IPLILQ--------LHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECR 117
            :||..|        .||..|            .:|.::.:.|..||...|        .|:.|.|
plant    21 VPLKAQDQPQDYFNAHNRAR------------VSVGVSPLMWSQTLTAYA--------QAYAEKR 65

  Fly   118 NTNTYRYAGQNLS------------ILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGG 170
                 |..|..||            |.|:....|:.||.|:      .:.|.|:.     ..|.|
plant    66 -----RDCGLFLSGGPYGETIKADIIDFSAEEFVSTFLNQK------SDYDYTTN-----TCRAG 114

  Fly   171 PAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNY 209
            .:...:..::..::..:|||..:   .|| ...|..|:|
plant   115 KSCDGYKQVLFRKSVFLGCAKVK---CNN-GGFLAICSY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 35/167 (21%)
AT4G07820NP_192524.1 CAP_PR-1 29..160 CDD:349400 33/161 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.