DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and AT3G19690

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:147 Identity:36/147 - (24%)
Similarity:60/147 - (40%) Gaps:29/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNL 129
            |:.|||.||            .|.:..:.||.   ::|||.|.......::|...::....|:|:
plant    30 LEAHNEARN------------EVGLDPLVWDD---EVAAYAASYANQRINDCALVHSNGPFGENI 79

  Fly   130 SILFTRSVDVAVFLRQRIAAWFDENR--DATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIA 192
            ::   .|.:::.  ......|.:|.:  |..|....|  ..||..: |:|.:|.:...|:|||..
plant    80 AM---SSGEMSA--EDAAEMWINEKQYYDYDSNTCND--PNGGTCL-HYTQVVWKNTVRLGCAKV 136

  Fly   193 RFTDANNVQATLLACNY 209
                ..|...|.:.|||
plant   137 ----VCNSGGTFITCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 36/147 (24%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 36/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.