DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and PRB1

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:165 Identity:43/165 - (26%)
Similarity:60/165 - (36%) Gaps:53/165 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IPLILQ--------LHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQ----CRMAH 113
            :||..|        .||:.|:.|..|            .|.||..||..|...|.|    ||:.|
plant    22 VPLKAQDSQQDYVNAHNQARSQIGVG------------PMQWDEGLAAYARNYANQLKGDCRLVH 74

  Fly   114 DECRNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDE----NRDATSGDMEDYQMRGGPAIG 174
            ...........:|.:||       .||.     :..|.:|    |.|..:.:         ...|
plant    75 SRGPYGENLAKSGGDLS-------GVAA-----VNLWVNEKANYNYDTNTCN---------GVCG 118

  Fly   175 HFTTMVNERNNRVGCAIARFTDANNVQATLLACNY 209
            |:|.:|...:.|:|||..|   .|| ..|:::|||
plant   119 HYTQVVWRNSVRLGCAKVR---CNN-GGTIISCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 42/163 (26%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.