DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:256 Identity:58/256 - (22%)
Similarity:98/256 - (38%) Gaps:74/256 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFLLYLVLIIFTFTFAQN------YCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLIL 65
            |..:|||:.......|.::      ..||:.                         :||    .|
Mouse    11 WTLVLYLIASRLPKAFGKDLPRVPTITDPKF-------------------------IDA----FL 46

  Fly    66 QLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDEC-----RNTNTYRYA 125
            .:|||.|..:.       |.|..|..:.||..||:||.....:|::||:.|     .....|.:.
Mouse    47 NIHNELRRKVQ-------PPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFI 104

  Fly   126 GQNLSI--LFTRSVDVAVFLRQRIAAWFDENR-----DATSGDMEDYQMRGGPAIGHFTTMVNER 183
            |:|:.:  :.|:..||.:       .|::|::     ..|..:|          .||:|.:|..:
Mouse   105 GENIYLGRIETQPEDVVI-------NWYNESKYFNFDFNTCSEM----------CGHYTQVVWAK 152

  Fly   184 NNRVGCAIARFTDANNVQATLLACNYA-VTNVVNNPVYRAGTAASECTTGRNSNYPNLCSP 243
            ..::|||::...:.....|.|..|||: ..|.:....|..|.:.|.|  |:.:...:||.|
Mouse   153 TVKIGCAVSNCPNLKGFSAGLFVCNYSPAGNFIGFRPYTRGDSCSMC--GQKTCENSLCRP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 39/158 (25%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 42/193 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841372
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.