powered by:
Protein Alignment CG32679 and Glipr2
DIOPT Version :9
Sequence 1: | NP_727412.2 |
Gene: | CG32679 / 318150 |
FlyBaseID: | FBgn0052679 |
Length: | 254 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006238202.1 |
Gene: | Glipr2 / 679819 |
RGDID: | 1583669 |
Length: | 170 |
Species: | Rattus norvegicus |
Alignment Length: | 68 |
Identity: | 17/68 - (25%) |
Similarity: | 31/68 - (45%) |
Gaps: | 10/68 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 WFDENRDATSGDMEDYQMRG-GPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAVTN 213
|:.|.:. .::|..| ....||||.||.:...::|...|..:|.::. ::|..:...|
Rat 99 WYSEIKS------YNFQQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSF---VVARYFPAGN 154
Fly 214 VVN 216
:||
Rat 155 IVN 157
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X35 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.