DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Glipr2

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_006238202.1 Gene:Glipr2 / 679819 RGDID:1583669 Length:170 Species:Rattus norvegicus


Alignment Length:68 Identity:17/68 - (25%)
Similarity:31/68 - (45%) Gaps:10/68 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 WFDENRDATSGDMEDYQMRG-GPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAVTN 213
            |:.|.:.      .::|..| ....||||.||.:...::|...|..:|.::.   ::|..:...|
  Rat    99 WYSEIKS------YNFQQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSF---VVARYFPAGN 154

  Fly   214 VVN 216
            :||
  Rat   155 IVN 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 14/60 (23%)
Glipr2XP_006238202.1 SCP_GAPR-1_like 24..155 CDD:240182 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.