DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:222 Identity:54/222 - (24%)
Similarity:87/222 - (39%) Gaps:49/222 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VDAHIPL---------ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMA 112
            ::|.:||         .:.||||.|..:       ||..|.:..|:||..|::.|.....:|..:
Mouse    38 LNAKLPLEEDVDFINEYVGLHNELRGTV-------FPPGVNLRFMTWDVALSRTARAWGKKCMYS 95

  Fly   113 HDECRNTN---------TYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRD---ATSGDMEDY 165
                |||:         .:...|:|:.:.......|...:|    :|.:|.:.   .....:||.
Mouse    96 ----RNTHLDKLHESHPVFTEIGENMWVGPVEDFTVTTAIR----SWHEERKSYSYLNDTCVEDQ 152

  Fly   166 QMRGGPAIGHFTTMVNERNNRVGCAIARFTDANN-VQATLLACNYAVTNVVNNPVYRAGTAASEC 229
            .      ..|:..:|.:.:.:||||:.....|.. ..|.|..||||....:....|:||...|.|
Mouse   153 N------CSHYIQLVWDSSYKVGCAVTSCARAGGFTHAALFICNYAPGGTLTRRPYQAGQFCSRC 211

  Fly   230 TTG-RNSNYPNLCS---PNEVYNYNQW 252
            ..| :.::|  |||   .:|...|..|
Mouse   212 GPGDQCTDY--LCSNTVRDEATYYQFW 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 37/168 (22%)
Glipr1l2NP_080499.1 SCP 49..194 CDD:294090 38/165 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841413
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.