DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and crispld2

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:268 Identity:72/268 - (26%)
Similarity:100/268 - (37%) Gaps:60/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRSPCWIFLLYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPL-- 63
            ||.:..||    |.|.:|.....|.||          :...|| .|:.....::.....|...  
 Frog     1 MSSAMNWI----LSLGLFFLLKEQCYC----------IFAPNS-TFLENLLNKYKDTTPHSRTRR 50

  Fly    64 ---------ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNT 119
                     |:||||:.|..:       .|||..|..|:||..|.:.|...|.:|...|..   |
 Frog    51 AILRTDKEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHGP---T 105

  Fly   120 NTYRYAGQNLSILFTRSVDVAVFLRQ---RIAAWFDENRDAT---SGDMEDY--QMRGGPAIGHF 176
            ......||||::.:.|       .||   .:.:|:||.:|.|   ..:...|  :...||...|:
 Frog   106 ALLMSIGQNLAVHWGR-------YRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHY 163

  Fly   177 TTMVNERNNRVGCAIARFTDANNV------QATLLACNYAVT-NVVNNPVYRAGTAASECTTGRN 234
            |.:|.....:||||: ......||      .|..|.|||:.. |.:....|:.|...|||.....
 Frog   164 TQIVWATTTKVGCAV-NVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYG 227

  Fly   235 SN-YPNLC 241
            .| ..|||
 Frog   228 GNCQNNLC 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 47/171 (27%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180 47/162 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281
LCCL 289..373 CDD:128866
LCCL 392..490 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.