DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and pi15a

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:203 Identity:68/203 - (33%)
Similarity:87/203 - (42%) Gaps:30/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQN 128
            ||..||:.|..:       ||.|..|..|.||.|||:.|...|..|...|..   .|..|:.|||
Zfish    72 ILDYHNKVRGKV-------FPPASNMEYMVWDDTLAKTAEQWASTCIWEHGP---RNLLRFLGQN 126

  Fly   129 LSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMR-----GGPAIGHFTTMVNERNNRVG 188
            ||:...|...:.    |.:..|.||.:|.:.....|...|     .||...|:|.||...:|:||
Zfish   127 LSVRTGRYRSIL----QLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVG 187

  Fly   189 CAIARFTDAN---NV--QATLLACNYAVT-NVVNNPVYRAGTAASECTT---GRNSNYPNLCSPN 244
            |||....:.|   :|  :||.|.|||:.. |.:....|:.|...|.|..   |..||  |:|.|.
Zfish   188 CAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSN--NMCFPA 250

  Fly   245 EVYNYNQW 252
            ...||..|
Zfish   251 VNSNYLHW 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 53/155 (34%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 53/155 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.