DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and pi15b

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:206 Identity:73/206 - (35%)
Similarity:88/206 - (42%) Gaps:36/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNE-RRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQ 127
            ||..||: |.|:        ||.|..|..|.||..||:.|...|..|...|..   ....||.||
Zfish    69 ILDYHNKVRANV--------FPPAANMEYMLWDDGLARSAEAWAATCIWEHGP---PYLLRYLGQ 122

  Fly   128 NLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQ----MR-GGPAIGHFTTMVNERNNRV 187
            |||:   |:.:....| |.:..|:||.||.......|..    || .||...|:|.||...:|||
Zfish   123 NLSV---RTGNYRSIL-QLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRV 183

  Fly   188 GCAIARFTDANNV-------QATLLACNYAVT-NVVNNPVYRAGTAASECTT---GRNSNYPNLC 241
            ||||.  |..|.|       :||.|.|||:.. |.:....||.|...|.|..   |..||  |:|
Zfish   184 GCAIQ--TCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSN--NMC 244

  Fly   242 SPNEVYNYNQW 252
            .|....|:..|
Zfish   245 FPAINSNFMYW 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 58/158 (37%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 58/158 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.