DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Glipr1l3

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:251 Identity:58/251 - (23%)
Similarity:96/251 - (38%) Gaps:64/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFLLYLVLIIFTFTFAQ------NYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLIL 65
            |...|||:.......|..      :..||:.                         :||    .|
Mouse    11 WTLALYLIATRLPKAFGNDLPRVPSILDPKF-------------------------IDA----FL 46

  Fly    66 QLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTN-----TYRYA 125
            .:|||.|..:.       |.|..|..:.||..||:||.....:|::.|:.|.:..     .|.:.
Mouse    47 NIHNELRRKVQ-------PPAADMNQVIWDQKLAKLAKAWTRECKLGHNPCTSKQYGCLLDYDFI 104

  Fly   126 GQNLSI--LFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVG 188
            |:|:.:  :.|:..||       :..|::||.|....|....::     ..::|.:|..:..::|
Mouse   105 GENIYLGEIETQPEDV-------VNNWYNENTDYNFVDNTCSKI-----CRNYTQLVWAKTFKIG 157

  Fly   189 CAIARFTDANNVQATLLACNYAVT-NVVNNPVYRAGTAASECTTGRNSNYPNLCSP 243
            ||::...:.....|.|..|||:.| |.::...||.|...|.|  |:.....:||.|
Mouse   158 CAVSNCPNLTRYSAGLFVCNYSPTGNFLDFRPYRKGDPCSMC--GQRKCENSLCRP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 37/153 (24%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 40/189 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.