DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and PI15

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:201 Identity:65/201 - (32%)
Similarity:84/201 - (41%) Gaps:26/201 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQN 128
            ||..||:.|..:       ||.|..|..|.||..||:.|...|..|...|..   :...|:.|||
Human    70 ILDYHNQVRGKV-------FPPAANMEYMVWDENLAKSAEAWAATCIWDHGP---SYLLRFLGQN 124

  Fly   129 LSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMR-----GGPAIGHFTTMVNERNNRVG 188
            ||:...|...:.    |.:..|:||.:|......:|...|     .||...|:|.||...:||:|
Human   125 LSVRTGRYRSIL----QLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIG 185

  Fly   189 CAIARFTDAN---NV--QATLLACNYAVT-NVVNNPVYRAGTAASECTTG-RNSNYPNLCSPNEV 246
            |||....:.|   :|  :|..|.||||.. |.:....|:.|...|.|... ..|...|||.|...
Human   186 CAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVT 250

  Fly   247 YNYNQW 252
            .||..|
Human   251 SNYLYW 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 50/155 (32%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 50/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151189
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.