DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and im:7150988

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002667823.1 Gene:im:7150988 / 504039 ZFINID:ZDB-GENE-050309-169 Length:150 Species:Danio rerio


Alignment Length:145 Identity:35/145 - (24%)
Similarity:57/145 - (39%) Gaps:41/145 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LQLHNERRN------LIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYR 123
            ||.||:.|:      |:       :...:..|...|       |.:...:..:.|.|..|     
Zfish    11 LQTHNQYRHQHQAPPLV-------YREDLCRAAQKW-------AEHMLSKKSLGHSETEN----- 56

  Fly   124 YAGQNLSILFTRSVDVAVFLRQRIAAWFDENRD---ATSGDMEDYQMRGGPAIGHFTTMVNERNN 185
              |:|:...|: ||......::.:.:|:.|.:|   |.||..        |..||||.:|.:.:.
Zfish    57 --GENVYYSFS-SVKKTPTGKEAVDSWYSEIKDYNFAKSGHQ--------PKTGHFTQVVWKSSK 110

  Fly   186 RVGCAIARFTDANNV 200
            .:|..:|  ||.|.|
Zfish   111 ELGVGLA--TDGNTV 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 35/145 (24%)
im:7150988XP_002667823.1 SCP_GAPR-1_like 5..135 CDD:240182 35/145 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.