DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:244 Identity:63/244 - (25%)
Similarity:93/244 - (38%) Gaps:52/244 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFLLYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHNER 71
            |...||||.......|.      ::.|   .|...|...|.:|              .|..|||.
  Rat    11 WTLALYLVASRLPKAFG------KVLP---RVPTINDPEFKNG--------------FLNSHNEA 52

  Fly    72 RNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRN-----TNTYRYAGQNLSI 131
            |..:.       |.|..|..:|||.:||:||.....:|:.:|:.|.:     |..|.|.|:|:.:
  Rat    53 RRKVQ-------PPASNMNQLSWDKSLAKLAKSWTRECKFSHNPCTSKRHGCTKDYDYIGENIYL 110

  Fly   132 --LFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIARF 194
              :..|..||       :.:|::|.:|....|....:     ..||:|.:|..:..::||||:..
  Rat   111 GKIDARPEDV-------VFSWYNETKDYNFDDNTCTK-----TCGHYTQVVWAKTLKIGCAISNC 163

  Fly   195 TDANNVQATLLACNYA-VTNVVNNPVYRAGTAASECTTGRNSNYPNLCS 242
            .......|.|..|||. ..|...:..|..|...|.|  |......:|||
  Rat   164 PHLTGYSAGLFVCNYVPAGNFQGSKPYIKGEPCSMC--GEKECVNSLCS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 42/153 (27%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 45/173 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.