DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and crisp1.3

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001008204.1 Gene:crisp1.3 / 493566 XenbaseID:XB-GENE-951048 Length:240 Species:Xenopus tropicalis


Alignment Length:210 Identity:48/210 - (22%)
Similarity:79/210 - (37%) Gaps:60/210 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LILQLHNE-RRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDEC-RNTNTYRYA 125
            :|:..||. |||        ..|||..|..|.|:...|..||..|..|..:|... :.|......
 Frog    37 IIINAHNNYRRN--------ASPSARNMLKMVWNKDAAINAASWAATCSESHSPSDKRTIPGFGC 93

  Fly   126 GQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSG---DMEDYQMRGGP-----AIGHFTTMVNE 182
            |:||            ::....|:|    .:|..|   :..|:|...||     ..||:|.::..
 Frog    94 GENL------------YMASYPASW----EEAVKGWYSEYNDFQYGVGPKSPGLVTGHYTQVMWY 142

  Fly   183 RNNRVGCAIA-------------RFTDANNVQATLLACNYAVTNVVNNPVYRAGTAASECTTG-R 233
            .:..|||:::             ::..|.|:.:|:           :.| |:.|...::|.|. .
 Frog   143 NSYMVGCSVSYCPKSPYKYFYVCQYCPAGNLDSTM-----------STP-YKTGPKCADCPTACD 195

  Fly   234 NSNYPNLCSPNEVYN 248
            |....|.|...::|:
 Frog   196 NGLCTNYCPYQDLYS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 39/169 (23%)
crisp1.3NP_001008204.1 CAP_CRISP 33..170 CDD:349402 36/156 (23%)
Crisp 187..240 CDD:369954 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.