DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and glipr2l

DIOPT Version :10

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001005978.1 Gene:glipr2l / 449805 ZFINID:ZDB-GENE-041010-53 Length:154 Species:Danio rerio


Alignment Length:85 Identity:20/85 - (23%)
Similarity:32/85 - (37%) Gaps:30/85 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 AWFDENRDATSGDMED----------YQMRG-GPAIGHFTTMVNERNNRVGC-----------AI 191
            ||  .:.|.|..|:.|          :...| ....||||.:|.:.:.::|.           .:
Zfish    68 AW--ASYDQTGKDVTDRWYNEVNQYNFNQPGFSSGTGHFTAVVWKGSKKLGVGKAVASDGSTFVV 130

  Fly   192 ARFTDANNV------QATLL 205
            ||:..|.|:      ||.:|
Zfish   131 ARYFPAGNITNQGHFQANVL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 CAP_euk 63..210 CDD:349399 20/85 (24%)
glipr2lNP_001005978.1 CAP_GAPR1-like 9..139 CDD:349401 16/72 (22%)

Return to query results.
Submit another query.