DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Ag5r

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:248 Identity:91/248 - (36%)
Similarity:138/248 - (55%) Gaps:8/248 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQV---DAHIPLILQLHNER 71
            :::.:.:.|....|.:|| .:.|.|.:::.|.|:|.:.|.|..:...:   .|....::...||.
  Fly     6 IIFSLSLAFGIASATDYC-KKSCGSTKNLGCDNNGAWASSCPSDATLLTLSSAEKDALVARTNEY 69

  Fly    72 RNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSIL-FTR 135
            ||.||||..:...:|.:|||:.|:..||.||:.|...|:|.||.|.||:.:.::||||:.: :..
  Fly    70 RNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTDAFDWSGQNLAWMGYYN 134

  Fly   136 SVDVAVFLRQRIAAWFDENRDATSGDMEDYQMR-GGPAIGHFTTMVNERNNRVGCAIARFT-DAN 198
            .::|..:|...:..|:||........::.|... .||||||||.:|.:||..||||.|.:: ...
  Fly   135 PLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAAATYSVSGQ 199

  Fly   199 NVQATLLACNYAVTNVVNNPVYRA-GTAASECTTGRNSNYPNLCSPNEVYNYN 250
            :.:|.|||||||.|||:...:|.: ..|||:||||.|..|..|||..|.||.|
  Fly   200 SYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGTNPKYKYLCSAKEEYNVN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 57/149 (38%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 57/151 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440533
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.