DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG8483

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster


Alignment Length:260 Identity:78/260 - (30%)
Similarity:109/260 - (41%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PCWIFLLYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHN 69
            |..:.|..:::|.....||.|         |:.:|        ||.:.|      ...:|||.||
  Fly     4 PSAVLLTTIMIISCEVAFACN---------GKIIA--------SGITAE------ERSIILQEHN 45

  Fly    70 ERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSILFT 134
            ..|.::|.|...|.|.|..|..:.||..||..|...|..|:..||..|..|.:. .||||:|:::
  Fly    46 RLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFT-MGQNLAIIWS 109

  Fly   135 RS---VDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIARFTD 196
            .:   .|...| ..||.:||:|.:..:.||      ...|..||::.:|....:.|||..|.:.|
  Fly   110 TAPLDADDGDF-PSRIQSWFNEVQKYSFGD------AWSPKTGHYSQLVWGETSLVGCGYAEYKD 167

  Fly   197 ANNVQATLLACNYAV-TNVVNNPVYRAGTAASECTT---GRNSNYPNLC-----SP--NEVYNYN 250
            .:... .|..|||.. .|||....|..|..:  |:|   ..:|.|..||     ||  |.||..|
  Fly   168 TSKYN-KLYVCNYGPGGNVVGYNPYEVGKPS--CSTYGMKPSSRYQGLCAAPGSSPAANSVYGAN 229

  Fly   251  250
              Fly   230  229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 49/149 (33%)
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 49/151 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455037
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.