DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scpr-A

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster


Alignment Length:255 Identity:95/255 - (37%)
Similarity:132/255 - (51%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEF--VQVDAHIPLILQLHNERR 72
            |..::|.:...:.|.:||....| ..:||||.|.|.|...|..:.  |:::.|..|||.|.||.|
  Fly     7 LQLILLAVVAISSAVDYCALPTC-LDKHVACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELR 70

  Fly    73 NLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSILF---- 133
            |.:|||.:.|.|.||:||.|||...|:.||..|...|....|:||:|..:.||||| :.||    
  Fly    71 NNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQN-NALFQYSG 134

  Fly   134 --TRSVDVAVFLRQRIAAWFDENRDATSGDMEDY-QMRGGPAIGHFTTMVNERNNRVGCAIARFT 195
              |...| |..:::.|..||.|..:|:...:..: :.....|:..||..|.|:|..||||..||:
  Fly   135 AETEYTD-AEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFS 198

  Fly   196 -DANNVQATLLACNYAVTNVVNNPVYRAGTAASECTTGRNS------NYPNLCSPNEVYN 248
             |..|  ..:|.||:|.:|:|..|||..|..|   |||..:      :|||||...|:|:
  Fly   199 RDFYN--HFVLTCNFATSNIVGQPVYTPGEKA---TTGCKNRYGAAYDYPNLCYAKEIYD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 61/154 (40%)
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 61/155 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440541
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.