DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scpr-C

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster


Alignment Length:252 Identity:90/252 - (35%)
Similarity:130/252 - (51%) Gaps:20/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEF--VQVDAHIPLILQLHNERRN 73
            |.|:..:...:.|.:||....| ..:|:||.|.|.|...|..:.  |:::.|..|||.|.||.||
  Fly     6 LILLTSLLGISLAADYCALPTC-LDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRN 69

  Fly    74 LIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSILFTRSVD 138
            .:|||.:.|.|.||:||.|||...|:.||..|...|....|:||:|..:.|||||.::......:
  Fly    70 NVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQYSGAE 134

  Fly   139 V----AVFLRQRIAAWFDENRDATSGDMEDY-QMRGGPAIGHFTTMVNERNNRVGCAIARFT-DA 197
            .    |..::::|..||.|..:|:...:..: :.....|:..||..|.|:|..||||..||: |.
  Fly   135 TEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDF 199

  Fly   198 NNVQATLLACNYAVTNVVNNPVYRAGTAASECTTGRNS------NYPNLCSPNEVYN 248
            .|  ..:|.||:|.:|:|..|||..|..|   |||..:      :|||||...|:|:
  Fly   200 YN--HFVLTCNFATSNIVGQPVYTPGEKA---TTGCKNRYGAAYDYPNLCYAKEIYD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 57/152 (38%)
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 57/153 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440547
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.