DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and crispld1b

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_009296842.1 Gene:crispld1b / 393442 ZFINID:ZDB-GENE-040426-1204 Length:509 Species:Danio rerio


Alignment Length:210 Identity:62/210 - (29%)
Similarity:89/210 - (42%) Gaps:46/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQ 127
            |||.|||:.|..:       :|.|..|..|.|||.|.:.|.:.|..|...|..   ::.....||
Zfish    65 LILDLHNKLRGQV-------YPPASNMEYMVWDTELERSAEHWAHTCLWEHGP---SHLLTRIGQ 119

  Fly   128 NLSILFTRSVDVAVFLRQR-----IAAWFDENRDATSGDMED------YQMRGGPAIGHFTTMVN 181
            ||.         |.:.|.|     :.||:||.||.:....::      |:. .||...|:|.:|.
Zfish   120 NLG---------AHWGRDRPPTFHVQAWYDEVRDFSYPYPQECNPHCPYRC-SGPVCTHYTQLVW 174

  Fly   182 ERNNRVGCAIARFTDANN-----VQATLLACNYAVT-NVVNNPVYRAGTAASECTTG-----RNS 235
            ..:|::||||....:.|.     .:|..|.|||:.. |...:..|:.||..|.|...     || 
Zfish   175 ATSNKIGCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHAPYKHGTPCSACPPSYGGGCRN- 238

  Fly   236 NYPNLCSPNEVYNYN 250
               |||..::..||:
Zfish   239 ---NLCYKDDGSNYH 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 48/162 (30%)
crispld1bXP_009296842.1 SCP_euk 64..208 CDD:240180 48/162 (30%)
LCCL 301..385 CDD:128866
LCCL 404..501 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585721
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.