DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG8072

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster


Alignment Length:250 Identity:69/250 - (27%)
Similarity:108/250 - (43%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LYLVLIIFTFT-FAQNYCDPELCPSGRHVACQNSGRFVSGC---SGEFVQVDAHIPLILQLHNER 71
            |:|..|:|..: .|.::||.:.|...||:.|.|:..|...|   .| .|.:......:|.|||..
  Fly     8 LFLCKILFLRSILAIDFCDIKSCHGKRHIGCDNNMMFDESCLRFHG-LVNMAYFREYLLGLHNGY 71

  Fly    72 RNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRM--AHDECRNTNT-----YRYAGQNL 129
            |..:|.......|.|.:|..:.||..|:.:|.|:..:|:|  ..|.|..|:.     :.||..  
  Fly    72 RQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAED-- 134

  Fly   130 SILFTRSV-------DVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRV 187
              .:.|.|       ::.:...|    |.||..|.  .|:..|.     |.|....::|:|::.:
  Fly   135 --FYPRPVIRQSNVREMTILAEQ----WLDELYDL--DDIATYS-----AEGEIRNIINDRSSYM 186

  Fly   188 GCAIARFTDANNVQATLLACNYAVTNVVNNPVYRAGT-AASECTTGRNSNYPNLC 241
            |||..:..|..|:. .:|.|.|:....|...:|..|. .|:.|..|::..|||||
  Fly   187 GCAAGQDYDLWNIH-FVLVCYYSSGPPVEGNLYEEGIFNATLCPNGQSDEYPNLC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 41/160 (26%)
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 41/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440618
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.