DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG34002

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster


Alignment Length:260 Identity:80/260 - (30%)
Similarity:122/260 - (46%) Gaps:20/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRSPC---WIFLLYLVLIIFTFTFAQNYCDPELCPSGR---HVACQNSGRFVSGCSGE--FVQV 57
            |...||   .:.||:.:.::|... ..|||..:.||:.:   |:.|.|||.:...|..:  .:.|
  Fly     1 MWSGPCVATGLLLLFGLNLVFLLP-ETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDV 64

  Fly    58 DAHI-PLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRM-AHDECRNTN 120
            ..|| .|||..||..|:::|||.:...|.|.:|..:.||..||.||.....:|.: ..|.|.:|.
  Fly    65 PKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTE 129

  Fly   121 TYR----YAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVN 181
            .:.    :|..|   .|....|....:|.::.||:|:.:..:|..:.|........||||..|:.
  Fly   130 EFSSPSYHAVYN---KFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIV 191

  Fly   182 ERNNRVGCAIARFTDANNVQATLLACNYAVTNVVNNPVYR-AGTAASECTTGRNSNYPNLCSPNE 245
            ..:||:|||||.. :........|||.|:.:...|:.:|. :|.....||||.|..:.|||:..|
  Fly   192 GPSNRLGCAIASI-EKGGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDTE 255

  Fly   246  245
              Fly   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 47/151 (31%)
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 47/153 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455058
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.