DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG34049

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:133 Identity:31/133 - (23%)
Similarity:44/133 - (33%) Gaps:57/133 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RNTNTYR----------------YAGQ------NLSILFTR-----------------SVDVAVF 142
            |.||.||                ||.:      :|:.|.||                 |||    
  Fly   151 RETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLYGENIMRVRRSKFSVD---- 211

  Fly   143 LRQRIAAWFDENRDATSGDMEDYQMRG-GPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLA 206
              |.:..|:.|..:      .||...| ....||||.:|...:..:|..:     |.:|.:..:.
  Fly   212 --QILKLWYQEKYN------YDYLKPGFNLYTGHFTQLVWRESEFLGVGV-----ACDVSSIWIV 263

  Fly   207 CNY 209
            |||
  Fly   264 CNY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 31/133 (23%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 31/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455106
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.