DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG3640

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster


Alignment Length:261 Identity:86/261 - (32%)
Similarity:129/261 - (49%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFLLYLVLIIFTFTFAQNYCDPELCP-SGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLH-- 68
            |...|.:|.:.....::.:||....|| |..||||.|:|.|...|..|    ...|||..||.  
  Fly     7 WFICLVIVTLNSFPAYSWDYCQEHWCPRSTDHVACNNNGTFGLDCGRE----ARLIPLSNQLQAF 67

  Fly    69 -----NERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQN 128
                 |..||.:|.||:|.|..|.:||::.||..|||||...|.:|.::.|.||||..:::.||.
  Fly    68 IVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQL 132

  Fly   129 LS-ILFT--RSVDVAVFLRQRIAAWFDE----NRDATSGDMEDYQMRGGPA--IGHFTTMVNERN 184
            .. ::|:  :..|:.: ||.:|:.||.:    ::|..:.|         |:  |..|..::.|.:
  Fly   133 TGHVIFSAGKHSDLEL-LRHKISNWFGQYMRASKDLQAAD---------PSSNISSFRQLIQESS 187

  Fly   185 NRVGCAIARFTDANNVQATLLACNYAVTNVVNNPVYRAGTAASECTTGRNSNYPNLCSPNEVYNY 249
            ..:||.:.|...........:.||:|..|:....||:.|.||:.|.:|||..|||||:..|.|:.
  Fly   188 THMGCGVLRQRSHMLWHQQFIVCNFARRNMPREQVYQVGVAATGCRSGRNPRYPNLCALQEEYDV 252

  Fly   250 N 250
            |
  Fly   253 N 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 48/162 (30%)
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 45/157 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440591
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.