DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG17974

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:268 Identity:106/268 - (39%)
Similarity:144/268 - (53%) Gaps:30/268 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SPCWIFLLYLVLIIFTFTFAQNY--CDPELCPSG-RHVACQNSGRFVSGCSGEFVQVDA--HIPL 63
            ||  :..|.:..:||....|::|  |||:||.:| ||:||:.:|.|...|..:.||||.  |...
  Fly     3 SP--LICLAIFQLIFQLILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRHKAD 65

  Fly    64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQN 128
            .|..||:|||.:|.|.|.|:..|.:||||.||..|..|:..|...|::.||:|.||..|..:|||
  Fly    66 FLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQN 130

  Fly   129 LSILF-TRS--VDVAVFLRQRIAAWFDENR--DATSGD-------MEDYQMRGGPAIGHFTTMVN 181
            |..:: .||  |:|...:.:.:..||:|..  |::..|       .|||        |||..:..
  Fly   131 LCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDY--------GHFAELSV 187

  Fly   182 ERNNRVGCAIARFT--DANNVQATLLACNYAVTNVVNNPVYRAGTAASECTTGRNSNYPNLCSPN 244
            ::|..|||:|.|||  |..:|......||||....:..|||..|.|||.||||::..||.|||..
  Fly   188 DKNFAVGCSIMRFTRPDYPSVYIYNFICNYASLYALGAPVYETGRAASRCTTGKSHFYPGLCSTR 252

  Fly   245 EVYNYNQW 252
            |||:.| |
  Fly   253 EVYDPN-W 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 58/160 (36%)
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 58/162 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440531
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 1 1.000 - - otm50802
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.