DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:198 Identity:48/198 - (24%)
Similarity:80/198 - (40%) Gaps:47/198 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VDAHIPL---------ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQC--- 109
            ::|.:||         .:.||||.|..:       ||..|.:..|:||..|::.|.....:|   
  Rat    40 LNAKLPLEEDVDFINEYVNLHNELRGTV-------FPPGVNLRFMTWDVALSRTARAWGKKCVFE 97

  Fly   110 RMAH-DECRNTN-TYRYAGQNLSI----LFTRSVDVAVFLRQRIAAWFDENR-----DATSGDME 163
            |..| |:...:: .:...|:|:.:    .||.:        ..|.:|.:|.:     :.|..:.|
  Rat    98 RNTHLDKVHESHPVFTDIGENMWVGPEKDFTAT--------NAIRSWHEERKSYNYVNDTCIEDE 154

  Fly   164 DYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNV-QATLLACNYAVTNVVNNPVYRAGTAAS 227
            |        ..|:..:|.:.:.:||||:........: .|.|..||||....:....|:||...|
  Rat   155 D--------CSHYIQLVWDHSYKVGCAVTPCAKVGAITYAALFICNYAPGGTLTRRPYQAGQFCS 211

  Fly   228 ECT 230
            .||
  Rat   212 RCT 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 38/170 (22%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 39/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.