powered by:
Protein Alignment CG32679 and CG17574
DIOPT Version :9
Sequence 1: | NP_727412.2 |
Gene: | CG32679 / 318150 |
FlyBaseID: | FBgn0052679 |
Length: | 254 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001246287.1 |
Gene: | CG17574 / 36415 |
FlyBaseID: | FBgn0033777 |
Length: | 175 |
Species: | Drosophila melanogaster |
Alignment Length: | 40 |
Identity: | 11/40 - (27%) |
Similarity: | 13/40 - (32%) |
Gaps: | 14/40 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 LVLIIFTFTFAQNYCD-------------PELCPSGRHVA 39
|:.||| ..|...||. |.:..|..|.|
Fly 27 LIAIIF-MLFIWGYCKCCCSCCKRNKTEAPVVVTSATHTA 65
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32679 | NP_727412.2 |
SCP_euk |
63..210 |
CDD:240180 |
|
CG17574 | NP_001246287.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.