powered by:
Protein Alignment CG32679 and Y39G8B.10
DIOPT Version :9
Sequence 1: | NP_727412.2 |
Gene: | CG32679 / 318150 |
FlyBaseID: | FBgn0052679 |
Length: | 254 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001022431.2 |
Gene: | Y39G8B.10 / 3565251 |
WormBaseID: | WBGene00012729 |
Length: | 140 |
Species: | Caenorhabditis elegans |
Alignment Length: | 33 |
Identity: | 7/33 - (21%) |
Similarity: | 11/33 - (33%) |
Gaps: | 13/33 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 YCDPELCPSGRHVACQNSGRFVSGCSGEFVQVD 58
||.|..|..| ..:.:|:.:|
Worm 119 YCSPGSCKDG-------------NAANQFLSLD 138
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32679 | NP_727412.2 |
SCP_euk |
63..210 |
CDD:240180 |
|
Y39G8B.10 | NP_001022431.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.