DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Clec18a

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_030099497.1 Gene:Clec18a / 353287 MGIID:2672935 Length:615 Species:Mus musculus


Alignment Length:240 Identity:58/240 - (24%)
Similarity:88/240 - (36%) Gaps:57/240 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFLLYLVLIIFTFTFA-----QNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQ 66
            |:.||.|:|.:...|:.     |...||.|....|..:.                      |||.
Mouse    90 WLGLLLLLLSLLGITWTEVQPPQPKQDPTLQALSRKESF----------------------LILT 132

  Fly    67 LHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQC------RMAHDECRNTNTYRYA 125
            .||..|:.:       .|.|..|..|.|..:|||||...|..|      .:|.....|:    :.
Mouse   133 AHNRLRSRV-------HPPAANMQRMDWSESLAQLAEARAALCVTSVTPNLASTPGHNS----HV 186

  Fly   126 GQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCA 190
            |.|:.::   .:..|.|: :.:..||.|......||.|   ........|:|.:|...::::||.
Mouse   187 GWNVQLM---PMGSASFV-EVVNLWFAEGLQYRHGDAE---CAHNATCAHYTQLVWATSSQLGCG 244

  Fly   191 IAR-FTDANNVQATLLAC----NYAVTNVVNNPVYRAGTAASECT 230
            ... |.|...::|.:.|.    |:.:......| |:.||..|.||
Mouse   245 RQPCFVDQEAMEAFVCAYSPGGNWDINGKTVAP-YKKGTWCSLCT 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 40/157 (25%)
Clec18aXP_030099497.1 CAP_euk 129..263 CDD:349399 39/151 (26%)
EGF_Lam 315..360 CDD:214543
CLECT 390..514 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.