DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG10651

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:254 Identity:81/254 - (31%)
Similarity:120/254 - (47%) Gaps:21/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFLLYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGC---SGEFVQVD-AHIPLILQLH 68
            |:||:..|.|.....:..:|..:|| .|:||.|.::|.|.|.|   :...|::. ..|.||:..|
  Fly     5 IWLLFSTLYIQDTGASDKWCKADLC-RGQHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKH 68

  Fly    69 NERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSI-- 131
            ||.||..| ||:...|.|.:|.|:.||..||::|.....:|....|:|..|..|.:|..:.|:  
  Fly    69 NEYRNKFA-GGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLEK 132

  Fly   132 --LFTRSVDVAVFLRQRIAAWFDEN-RDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIAR 193
              ..|...:.   ||:::..|||.| :|........:.........::..::.:|.|||||||..
  Fly   133 YFCMTTKKEA---LRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIVE 194

  Fly   194 FTDANNVQATLLACNY----AVTNVVNNPVYR--AGTAASECTTGRNSNYPNLCSPNEV 246
            :.....|. .||.|.|    ::....:||||.  ...|||||..|.|..|.|||..:|:
  Fly   195 YVRPALVH-QLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHKDEL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 47/155 (30%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 47/153 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.