DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CLEC18A

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_016878695.1 Gene:CLEC18A / 348174 HGNCID:30388 Length:476 Species:Homo sapiens


Alignment Length:190 Identity:45/190 - (23%)
Similarity:64/190 - (33%) Gaps:53/190 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYA-- 125
            |:|.|||..|:.:.       |.|..|..:.|..:|||||...|..|        .|.|...|  
Human    50 LLLSLHNRLRSWVQ-------PPAADMRRLDWSDSLAQLAQARAALC--------GTPTPSLASG 99

  Fly   126 -------GQNLSIL---FTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGG-----PAIGH 175
                   |.|:.:|   ....|:|       ::.||.|.        :.|....|     ....|
Human   100 LWRTLQVGWNMQLLPAGLVSFVEV-------VSLWFAEG--------QRYSHAAGECARNATCTH 149

  Fly   176 FTTMVNERNNRVGCAIARFTDANNVQATLLACNYAVTN--VVNNPV---YRAGTAASECT 230
            :|.:|...::::||. .....|.........|.|:...  .||...   |:.|...|.||
Human   150 YTQLVWATSSQLGCG-RHLCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKGAWCSLCT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 37/163 (23%)
CLEC18AXP_016878695.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151059
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.