DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG4270

DIOPT Version :10

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster


Alignment Length:113 Identity:34/113 - (30%)
Similarity:49/113 - (43%) Gaps:20/113 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 AAYNALQCRMA-HDECRNTNTYR----YAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGD 161
            ||.|.|....| |...:||..:|    | |:|  |..:..:||...|  .:..|:   |:..|.|
  Fly    55 AALNKLAQEWANHLRDQNTMAHRPNPKY-GEN--IFLSGGMDVTGDL--PVEMWY---REINSYD 111

  Fly   162 MEDYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNY 209
            ....|.  .|..||||.::.:.:..:|..:||..|     .|.:.|||
  Fly   112 FNKAQF--VPTAGHFTQLIWKSSVEMGSGVARKAD-----RTWVVCNY 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 CAP_euk 63..210 CDD:349399 34/113 (30%)
CG4270NP_608663.1 CAP_GAPR1-like 31..158 CDD:349401 34/113 (30%)

Return to query results.
Submit another query.