DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and glipr2

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_021327299.1 Gene:glipr2 / 325699 ZFINID:ZDB-GENE-030131-4424 Length:543 Species:Danio rerio


Alignment Length:189 Identity:43/189 - (22%)
Similarity:62/189 - (32%) Gaps:62/189 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAH---DECRNTNTYRYA- 125
            ||:||..|.      ..|.|.                ..:|...||.|.   :...:|.|..:: 
Zfish    11 LQVHNAYRK------QHGAPP----------------LTFNKNLCRSAQQWAEHLLSTKTLAHSN 53

  Fly   126 ---GQNLSILFTRSVDVAVFLRQRIAAWFDENR--------DATSGDMEDYQM-RGG--PAIGHF 176
               |:||                 ..||...|:        |:..|:::||.. |.|  ...|||
Zfish    54 KGYGENL-----------------YYAWSSANKKLTGNEAVDSWYGEIKDYNFSRPGFSSKTGHF 101

  Fly   177 TTMVNERNNRVGCAIARFTDANNVQAT---LLACNYAVTNVVNNPVYRAGTAASECTTG 232
            |.:|.:....:|..:|  ||.|.:...   |.|.|.|........|...|:...:..||
Zfish   102 TQVVWKDTKELGVGLA--TDGNTIFVVGQYLPAGNIANAGYFEKNVLPTGSKLDQKPTG 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 38/165 (23%)
glipr2XP_021327299.1 SCP_GAPR-1_like 5..135 CDD:240182 37/164 (23%)
SCP_GAPR-1_like 196..326 CDD:240182
SCP_GAPR-1_like 397..528 CDD:240182
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.