DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG9400

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster


Alignment Length:290 Identity:95/290 - (32%)
Similarity:143/290 - (49%) Gaps:52/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SPCWIFLLY--------------------LVLIIFTFTFAQN--YCDPELCP--SGRHV------ 38
            |.|.:|.|:                    |:..|.|.|.|.:  ||...||.  :|.|:      
  Fly     6 SKCSVFALWAPAVLLFVLACEKGLAGAQTLIETITTTTPASSGGYCAAALCELYNGTHLVHVPHT 70

  Fly    39 ACQNSGRFVSGCSGE---FVQVDAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQ 100
            ||.|:|.|...|..|   ....:....|:|.:||..|:.||.|.:.|:.||..|..:.|||.|.|
  Fly    71 ACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQ 135

  Fly   101 LAAYNALQCRMAHDECRNTNTYRYAGQNLSILF--------TRSVDVAVFLRQRIAAWFDENRDA 157
            :||.:|.:|:.|||:||||..::::|||:...:        :|.      ::..:..||.|::||
  Fly   136 MAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRR------MKSFVINWFREHQDA 194

  Fly   158 TSGDMEDYQMR-GGPAIGHFTTMVNERNNRVGCAIARFTD--ANNVQATLLACNYAVTNVVNNPV 219
            ....::.|... .|..|||||.:|::|.||||||..||.:  :|..| .:|.|||...|:.|.|:
  Fly   195 NQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQ-FMLTCNYDYNNIFNEPI 258

  Fly   220 YRAGTAASECTTGR-NSNYPNLCSPNEVYN 248
            |::|.|.|:|...| :..:|:||...:..|
  Fly   259 YQSGPAGSKCPQHRISEKFPSLCDWRDANN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 59/157 (38%)
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 59/159 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440622
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
99.010

Return to query results.
Submit another query.