DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and CG31286

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:254 Identity:47/254 - (18%)
Similarity:81/254 - (31%) Gaps:85/254 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFLLYLVLII-FTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHNER 71
            :.:::||.|. |...||.|:              .|:|                  ::|:..|:|
  Fly     7 LVIVFLVAISEFDRNFAINH--------------DNAG------------------IVLREINKR 39

  Fly    72 R-----------NLIAGGGVSGFPSAVQMATMSW-DTTLAQLAAYNALQCRM-----AHDEC-RN 118
            |           |:::.|..|......:.||::: |.|...   |....||.     |...| :|
  Fly    40 RDRHGVPKLTLDNVLSKGCQSYAWKLSKSATLNYSDPTNKD---YTESICRFEVKRGALSRCVKN 101

  Fly   119 TNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNER 183
            .    |.|:...||..::.|....:      |                 |...::|:....:|..
  Fly   102 W----YNGRKFDILDPKAKDFTAMI------W-----------------RSSVSLGYGDANINAL 139

  Fly   184 NNRVGCAIARFTDANNVQATLLACNYAVTNVVNNPVYRAGTAASECTTGRNSNYPNLCS 242
            .   |..:.|:|...||:. |...|............|......:|.:.:::.|..|.|
  Fly   140 Q---GVFVVRYTPPGNVKG-LYTDNVPPRKRKQKKKKRENKQKEDCASRQDNRYVLLLS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 33/164 (20%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 31/176 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455148
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.