DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Clec18a

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:251 Identity:59/251 - (23%)
Similarity:85/251 - (33%) Gaps:78/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFLLYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIP--------- 62
            |:.||.|:|.:...|:.      |:.|.                     |:...:|         
  Rat    37 WLGLLLLLLPLLGITWT------EVQPP---------------------QLPKQVPIVQALSRKE 74

  Fly    63 --LILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHD-----ECRNTN 120
              |||..||..|:.:       .|||..|..|.|..:|||||...|..|..:..     ..|||.
  Rat    75 SFLILTTHNRLRSQV-------HPSAANMQRMDWSESLAQLAQARAALCGTSATPNLAATLRNTP 132

  Fly   121 TYRYAGQNLSIL------FTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTM 179
            .   .|.|:.:|      |...|:|          ||.|......|..|   ........|:|.:
  Rat   133 D---VGWNVQLLPMGSASFVEVVNV----------WFAEGLQYRHGSAE---CAHNATCAHYTQL 181

  Fly   180 VNERNNRVGCAIAR-FTDANNVQATLLAC----NYAVTNVVNNPVYRAGTAASECT 230
            |...::::||.... |.|....:|.:.|.    |:.:...:..| |:.|...|.||
  Rat   182 VWATSSQLGCGWQPCFVDQVATEAFVCAYSPGGNWEINGKMIAP-YKKGPWCSLCT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 43/162 (27%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 42/156 (27%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.