DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Glipr1

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:215 Identity:56/215 - (26%)
Similarity:86/215 - (40%) Gaps:51/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SGCSGEFVQVDAHIPLI---------LQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAA 103
            |..|| |....:.:|.|         :::||..|:       ..:|.|..|..||||..|||:|.
  Rat    13 SSASG-FSYTASTLPKITNEDFIEECVEVHNHFRS-------KAYPPAGNMLYMSWDPKLAQIAK 69

  Fly   104 YNALQCRMAHD---ECRNTNTYRYAGQNLSI----LFTRSVDVAVFLRQRIAAWFDENR--DATS 159
            ..|..|...|:   ..|....:...|:|:.:    ||:        :|..|.|||:|::  |.::
  Rat    70 AWAQSCVFQHNPQLHSRIHPNFTGLGENIWLGSLSLFS--------VRAAILAWFEESQYYDFST 126

  Fly   160 GDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAVTNVVNNPV--YRA 222
            |..:       ...||:|.:|...:.::|||:.......|     ..|||....  |.|.  |:.
  Rat   127 GKCK-------KVCGHYTQIVWADSYKIGCAVQLCPRGAN-----FICNYGPAG--NYPTWPYKQ 177

  Fly   223 GTAASECTTGRNSNYPNLCS 242
            |...|.|... :....|||:
  Rat   178 GATCSACPKD-DKCLNNLCT 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 41/164 (25%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 41/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344705
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.