DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and Pi16

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:190 Identity:52/190 - (27%)
Similarity:77/190 - (40%) Gaps:36/190 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQN 128
            :::|||..|..::       |.|..|..|.||..||..|...|.:|...|::.|...     |:|
  Rat    42 MVELHNHYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-----GEN 94

  Fly   129 LSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMR-----GGPAIGHFTTMVNERNNRVG 188
            |..:....:||.:    .:..|.:|:        |.|.:.     .|...||:|.:|..:..|:|
  Rat    95 LFAITDEGMDVPL----AVGNWHEEH--------EYYNLSTATCDPGQMCGHYTQVVWSKTERIG 147

  Fly   189 CAIARFTD----ANNVQATLLACNYAVT-NVVNNPVYRAGTAASECTTGRNSNYPNLCSP 243
            |. :.|.:    .......||.|||... ||.....|:.||..|:|..| .|...:||.|
  Rat   148 CG-SHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLG-YSCVNSLCEP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 39/154 (25%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 39/154 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.