DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and F09B9.5

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001024544.1 Gene:F09B9.5 / 259721 WormBaseID:WBGene00008604 Length:184 Species:Caenorhabditis elegans


Alignment Length:178 Identity:38/178 - (21%)
Similarity:69/178 - (38%) Gaps:43/178 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EFVQVDAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECR 117
            |||.     .::|: ||.||.:.:...:.......:|| ..|...||:       |..::..|..
 Worm     9 EFVD-----QMLLE-HNTRRKMHSAPNLECSEELSEMA-QQWADKLAK-------QAHISFSELS 59

  Fly   118 NTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNE 182
            .      .|:|:: .|...:|.    ...:..|:.|:      :..:|:..|.....::.|.|..
 Worm    60 G------IGENIT-FFPPDIDA----ESVVEHWYQEH------EKYEYETPGWQTGTNYFTQVIW 107

  Fly   183 RNNR---VGCAIARFTDANNVQATLLACNYAVTNVVNNPVYRAGTAAS 227
            |:.:   ||||..|.:..|:...|  :|:       |..|.::.|:.|
 Worm   108 RSTKEIGVGCAYVRKSHENDEDNT--SCS-------NGSVCKSMTSLS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 31/149 (21%)
F09B9.5NP_001024544.1 CAP_GAPR1-like 9..168 CDD:349401 38/178 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.