DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:242 Identity:60/242 - (24%)
Similarity:96/242 - (39%) Gaps:54/242 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFLLYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHNERR 72
            :::|.|.|:..|.:...:..||               .|:..|              ::.|||.|
Human    95 LWILGLCLVATTSSKIPSITDP---------------HFIDNC--------------IEAHNEWR 130

  Fly    73 NLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTN-----TYRYAGQNLSIL 132
                 |.|:  |.|..|..|.||..||::|...|.||:..|::|.:.:     .:.|.|:|:.:.
Human   131 -----GKVN--PPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLG 188

  Fly   133 FTRSVDVAVFLRQRIAAWFDENRDATSGDMEDY-QMRGGPAIGHFTTMVNERNNRVGCAIARFTD 196
            ..:|...    |..|.||::|.:      ..|: .:......||:|.:|...:..||||:|...:
Human   189 GIKSFTP----RHAITAWYNETQ------FYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPN 243

  Fly   197 ANNVQATLLACNYA-VTNVVNNPVYRAGTAASECTTGRNSNYPNLCS 242
            .......:..|||. ..|..|.|.|..|.:.|.|:. ......|||:
Human   244 LGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSK-EEKCVKNLCN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 41/152 (27%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151294
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.