DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and antr

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:115/272 - (42%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFLLYLVLIIFTFTFAQN---YCDPELCPSGR-HVACQNSGRFVSGCSGE-------FVQVDAHI 61
            ::.|||.|:..|.:....   :|.|.||.:.. ||.|     |.....||       |:.|:..:
  Fly     3 MWYLYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGC-----FQPKAVGEQCGKNNLFLNVNGAL 62

  Fly    62 PL-ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYA 125
            .. ||...|..||.:| .||..:..|.:|.||.||..|.:||.....||......|.||:.|.|.
  Fly    63 KTGILSRINMLRNYVA-SGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYV 126

  Fly   126 ---------GQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQ----MRGGPAIGHFT 177
                     |:      |:|:..|:..:.....:.|     ..|.|.:.|    :|.|..:||:.
  Fly   127 ATTEIRSKMGR------TKSLKSAILDKLLPELFLD-----VMGCMMNSQKLVPVREGTCVGHYM 180

  Fly   178 TMVNERNNRVGCAI---ARFTDANNVQATLLACNYAVTNVVNNPVYRAG-TAASECTTGRNSNYP 238
            .::.:..:|:||.:   .|....:|:   :|.|:::..:|.|...|..| ..|.:|.||.:..|.
  Fly   181 PLIQDHGSRMGCGLRVKGRDEKESNI---ILLCHFSRASVNNLVPYEEGQIPAGKCATGPSQMYQ 242

  Fly   239 NLCSPNEVYNYN 250
            .|||.:|..:.|
  Fly   243 FLCSEDEYVDAN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 43/163 (26%)
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 43/164 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440617
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.