DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-18

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502228.2 Gene:scl-18 / 188436 WormBaseID:WBGene00011724 Length:225 Species:Caenorhabditis elegans


Alignment Length:202 Identity:45/202 - (22%)
Similarity:80/202 - (39%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNERRNLIAGGGV-----SGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYR 123
            :|..||..|:.:|.|..     :...:...:....|:.|| :.:||:..|        :|.:.:.
 Worm    41 VLDHHNNIRSQLAFGNFVTKRHTKRAAGSNIKKFVWNATL-ERSAYSFAQ--------KNPSQHS 96

  Fly   124 Y---AGQNLSILF----TRSVDVAVFLRQRIAAWFDENRD------ATSGDMEDYQMRGGPAIGH 175
            :   .|:|   ||    ||..|...:......:|..|.|:      ..:.|:      .|..:||
 Worm    97 FIPDIGEN---LFWHWSTRPGDFNKYGPMAALSWIKEFREKFWDSNILTNDL------FGSGVGH 152

  Fly   176 FTTMVNERNNRVGCAIARFTDANN-----VQATLLACNY-AVTNVVNNPVYRAGTAASECTTGRN 234
            .|.||.....::|||::.|.:.:.     :....:.|:| ...|.:|.|:|..|...|:|.:.:.
 Worm   153 ATQMVWADTYQMGCAVSHFKEIHKRTGRPITKICVVCHYWPKGNYLNEPIYLEGPPCSKCESKKC 217

  Fly   235 SNYPNLC 241
            .....||
 Worm   218 DKRTGLC 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 36/169 (21%)
scl-18NP_502228.2 SCP 37..193 CDD:214553 36/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.