DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-1

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502502.1 Gene:scl-1 / 186053 WormBaseID:WBGene00004742 Length:207 Species:Caenorhabditis elegans


Alignment Length:181 Identity:52/181 - (28%)
Similarity:73/181 - (40%) Gaps:24/181 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNERRNLIA-----GGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYR 123
            |:..||:.|:.||     ..|....| |..|..|..|:|:|..|...|..|...|.  :.|.   
 Worm    24 IVDAHNKLRSAIAKSTYVAKGTKKEP-ATDMRKMVVDSTVAASAQNYANTCPTGHS--KGTG--- 82

  Fly   124 YAGQNLSILFTRSVDVA---VFLRQRIAAWFDENRDA--TSGDMEDYQMRGGPAIGHFTTMVNER 183
             .|:||...:| |.||.   .:.....|||..|.:|.  .|..|:......|  |||.|.|....
 Worm    83 -YGENLYWSWT-SADVGSLDSYGEIAAAAWEKEFQDFGWKSNAMDTTLFNSG--IGHATQMAWAN 143

  Fly   184 NNRVGCAI---ARFTDANNVQATLLACNYAVT-NVVNNPVYRAGTAASECT 230
            .:.:||.:   .|.....|:....:.|.|:.. |.:..|:|:.||..|.|:
 Worm   144 TSSIGCGVKNCGRDASMRNMNKIAVVCQYSPPGNTMGRPIYKEGTTCSSCS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 44/158 (28%)
scl-1NP_502502.1 SCP 19..174 CDD:214553 45/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.