DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-11

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502499.1 Gene:scl-11 / 186050 WormBaseID:WBGene00009892 Length:207 Species:Caenorhabditis elegans


Alignment Length:219 Identity:52/219 - (23%)
Similarity:84/219 - (38%) Gaps:33/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VACQNSGRFVSGCSGEFVQVDAHIPLILQLHNERRNLIAGG-----GVSGFPSAVQMATMSWDTT 97
            |.|      ::|...:|......  .|:..||:.|:.||.|     |.:. .|...|..:.||.|
 Worm     8 VCC------IAGVFSQFTSTGQQ--AIVDAHNKLRSSIAKGTYVAKGTTQ-KSGSNMRKIKWDAT 63

  Fly    98 LAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSILFTRSV--DVAVFLRQRIAAWFDENRD---- 156
            :|..|...|..|...|.:   .:.|   |:||...:|...  ::..|.....::|..|.:.    
 Worm    64 VATSAQNYANTCPTGHSQ---GSGY---GENLYWYWTSGTIGNLDTFGPAASSSWESEFQQYGWT 122

  Fly   157 ATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIARF--TDANNVQATLLACNYAVT-NVVNNP 218
            :.:.||..:    ...|||.|.|.......:||.:...  ..:|......:.|.|... |.:|.|
 Worm   123 SNTLDMNTF----NTGIGHATQMAWANTFAIGCGVKNCGKDPSNGYNKVAVVCQYKTPGNYLNQP 183

  Fly   219 VYRAGTAASECTTGRNSNYPNLCS 242
            :|:.||..:.|.:|...:...||:
 Worm   184 IYQQGTTCAACPSGTACDSSGLCA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 37/159 (23%)
scl-11NP_502499.1 SCP 21..173 CDD:214553 37/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.