DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-10

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502498.1 Gene:scl-10 / 186049 WormBaseID:WBGene00009891 Length:212 Species:Caenorhabditis elegans


Alignment Length:247 Identity:60/247 - (24%)
Similarity:98/247 - (39%) Gaps:49/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CWIFLLYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHNE 70
            |:..|:.|::    |:|.:..|  |...:|::                         .||..||.
 Worm     3 CYFRLICLLI----FSFCETLC--EFSETGKN-------------------------YILSRHNY 36

  Fly    71 RRNLIAGG----GVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNL-- 129
            .|:.||.|    |.|..|||..|..:.|||||...|...:..|...|...|..     .|:|:  
 Worm    37 LRSQIALGKYVAGNSTKPSASNMMKLIWDTTLETTAQDYSTGCPTGHSASRAN-----IGENMYW 96

  Fly   130 --SILFTRSVDVAVFLRQRIAAWFDE-NRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAI 191
              |.:.|:: |..:...:....|..| .|...:|::...::... .|||.|.|.....|::||.|
 Worm    97 WTSPVVTQT-DAELLGNRSANLWESEFQRFGWNGNLLTEELFNS-GIGHATQMAWATTNKIGCGI 159

  Fly   192 ARFTDANNVQATLLACNYA-VTNVVNNPVYRAGTAASECTTGRN-SNYPNLC 241
            ::.:..:.....::.|.|: ..|.:...:|::|...|.|..|.| .:...||
 Worm   160 SKCSSDSFGTQYVVVCLYSPAGNYIGMDIYKSGETCSNCPDGTNCESSTGLC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 42/155 (27%)
scl-10NP_502498.1 SCP 25..179 CDD:214553 44/185 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.