DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-14

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502532.1 Gene:scl-14 / 184246 WormBaseID:WBGene00008625 Length:208 Species:Caenorhabditis elegans


Alignment Length:195 Identity:53/195 - (27%)
Similarity:80/195 - (41%) Gaps:21/195 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CSGEFVQVDAH-IPLILQLHNERRNLIAGG-----GVSGFPSAVQMATMSWDTTLAQLAAYNALQ 108
            |:|.:.|..|: ...||.:||..|:.||.|     |.... :|..|..|.|..:||..:...|.:
 Worm    12 CAGAYTQFTANGQAAILNVHNTLRSRIAKGTYVARGTVKH-AASDMLKMKWLRSLATSSQIYANR 75

  Fly   109 CRMAHDECRNTNTYRYAGQNLSILFTRS--VDVAVFLRQRIAAWFDENRDA--TSGDMEDYQMRG 169
            |...|.....      .|:||...:|..  .::..|.....|||..|.:|.  :|..:.......
 Worm    76 CPTGHSNMIG------VGENLYWYWTSGTITNIDQFGAMASAAWEKEFQDYGWSSNTLTMSLFNS 134

  Fly   170 GPAIGHFTTMVNERNNRVGCAIARF-TDANNVQATLLACNYAVT-NVVNNPVYRAGTAASECTTG 232
            |  :||.|.|...:.|.:||.:... .|.|.:....:.|:|... |.:|..:|.:||..|:|..|
 Worm   135 G--VGHATQMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHYQPQGNYLNQNIYTSGTTCSKCPAG 197

  Fly   233  232
             Worm   198  197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 40/156 (26%)
scl-14NP_502532.1 SCP 22..175 CDD:214553 41/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.