DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-24

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_507429.1 Gene:scl-24 / 184188 WormBaseID:WBGene00008575 Length:212 Species:Caenorhabditis elegans


Alignment Length:195 Identity:37/195 - (18%)
Similarity:68/195 - (34%) Gaps:33/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNERRNLIAGG-----GVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYR 123
            |:.:||:.||..:.|     .:|   .:..|..:||:.:|..........|..|.    |.|...
 Worm    34 IVFIHNKLRNAASHGLWERYSIS---KSSNMQLLSWNESLVAEVENEKYYCEPAD----NKNLPI 91

  Fly   124 YAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSG-DMEDYQMRGGPAIGHFTTMVNERNNRV 187
            ..|.|:......:.|..    ..:.|....|:|..:. ..|:...:     .....|:..::..:
 Worm    92 KLGDNIYQYDVNTYDDI----DGVGAMGSINKDTHNALKSEEKATK-----NRLRQMLYSKSKSI 147

  Fly   188 GCAIARFTDAN----NVQATLLACNYA--VTNVVNNPVYRAGTAASECTTGRNSNYPNLCSPNEV 246
            ||........:    |....|:.|.|:  :.| ::..::..|...|.|.:|.:..    ..|||:
 Worm   148 GCIYESCDKIDSKGINYNTRLVICKYSPPLEN-IDEQLFDKGEPCSNCPSGTSCG----TDPNEM 207

  Fly   247  246
             Worm   208  207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 28/155 (18%)
scl-24NP_507429.1 CAP_euk 31..174 CDD:349399 28/155 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.