DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32679 and scl-15

DIOPT Version :9

Sequence 1:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_494496.1 Gene:scl-15 / 184099 WormBaseID:WBGene00017183 Length:207 Species:Caenorhabditis elegans


Alignment Length:185 Identity:45/185 - (24%)
Similarity:70/185 - (37%) Gaps:37/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILQLHNERRNLIAGGGVSGFPSAVQ----MATMSWDTTLAQLAAYNALQCRMAHDECR-NTNTY- 122
            |:..||..|:.||.|......:..:    :..|.||.|:|:.|...|..|...|.:.: ..|.| 
 Worm    27 IVDAHNTLRSSIAKGTYVANKTRKEPGSNILKMKWDPTIAKSAQAYANTCPTGHGKSKYGENLYW 91

  Fly   123 RYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRG-----------GPAIGHF 176
            |::|..:     :|:|             |....|:.....::|..|           ...|||.
 Worm    92 RWSGAVI-----KSID-------------DYGVRASGAWASEFQKYGWKTNKLDSALFKTGIGHA 138

  Fly   177 TTMVNERNNRVGCAIARF-TDANNVQATLLACNYAVT-NVVNNPVYRAGTAASEC 229
            |.|.......:||.:... .|.|.:....:.|.|:.. |::||.:|.||...|.|
 Worm   139 TQMAWASTGSIGCGVKNCGMDKNKMYKVAVVCQYSARGNMINNNIYTAGKTCSAC 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 36/163 (22%)
scl-15NP_494496.1 SCP 22..173 CDD:214553 36/163 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.